Zestly Logo
Zestly®
Home
/ Crispy Almond-Crusted Chicken Milanese
Back to Recipes
Crispy Almond-Crusted Chicken Milanese

Crispy Almond-Crusted Chicken Milanese

Italian540 cal20 min prep15 min cookMedium4 servings
Gluten-Free High-Protein

Golden pan-fried chicken cutlets in a nutty almond-flour crust, topped with a bright arugula and cherry tomato salad. Naturally gluten-free comfort food that still shatters at the first bite.

Created by Priya Kaur
chickenitaliancrispyweeknightseed-chef

Ingredients

Serves 4

Instructions

  1. 1

    Pound the chicken breasts to an even half-inch thickness between two sheets of parchment.

  2. 2

    Set up a breading station: beaten eggs in one bowl, and almond flour, gluten-free breadcrumbs, parmesan, salt, and pepper mixed in another.

  3. 3

    Dip each cutlet in egg, then press firmly into the almond mixture to coat both sides.

  4. 4

    Heat olive oil in a large skillet over medium-high heat until shimmering.

  5. 5

    Fry the cutlets 3 to 4 minutes per side until deep golden and cooked through, then drain on paper towels.

  6. 6

    Toss arugula and halved cherry tomatoes with a squeeze of lemon and a drizzle of olive oil.

  7. 7

    Plate each cutlet, pile the salad on top, and serve with lemon wedges.

Other Recipes You Might Like

Butternut Squash Sage Risotto
Hard
Italian

Butternut Squash Sage Risotto

Creamy slow-stirred arborio risotto folded with roasted butternut squash and crispy sage butter. An elegant, velvety autumn dinner worth the stirring.

60 min
4 servings
dinnercomfortautumn

By Nina Marchetti

View Recipe
Crispy Coconut Shrimp with Sweet Chili Sauce
Medium
Thai

Crispy Coconut Shrimp with Sweet Chili Sauce

Shrimp coated in shredded coconut and gluten-free breadcrumbs, fried golden and crunchy, served with a sticky sweet chili dip. An irresistible crowd-pleaser.

32 min
4 servings
shrimpthaifried

By Priya Kaur

View Recipe
Seared Hanger Steak with Red Wine Shallot Sauce
Medium
French

Seared Hanger Steak with Red Wine Shallot Sauce

The butcher's cut done bistro-style: a well-seared hanger steak napped in a silky red wine and shallot reduction. Deeply flavorful and elegantly simple.

35 min
2 servings
hanger steakfrenchbistro

By Diego Alvarez

View Recipe

Want to Make Your Own Recipe?

Zestly's AI-powered recipe creator helps you design custom recipes tailored to your taste, ingredients, and dietary needs.

Create Your Recipe Now