Zestly Logo
Zestly®
Home
/ Peruvian Aji Amarillo Grilled Shrimp Skewers
Back to Recipes
Peruvian Aji Amarillo Grilled Shrimp Skewers

Peruvian Aji Amarillo Grilled Shrimp Skewers

Peruvian232 cal20 min prep8 min cookEasy4 servings
Pescatarian Gluten-Free Dairy-Free Nut-Free Paleo Whole30 High-Protein Low-Carb

Jumbo shrimp marinated in golden aji amarillo, garlic and lime, then flame-grilled until just charred. Sweet, spicy and smoky all at once.

Created by Mateo Rossi
shrimpperuviangrilledskewersspicyseed-chef

Ingredients

Serves 4

Instructions

  1. 1

    Whisk aji amarillo, garlic, lime juice, olive oil, cumin and salt into a marinade.

  2. 2

    Toss the shrimp in the marinade and rest for 15 minutes.

  3. 3

    Thread the shrimp onto skewers.

  4. 4

    Heat a grill to high and oil the grates.

  5. 5

    Grill the skewers 2 to 3 minutes per side until pink and lightly charred.

  6. 6

    Shower with cilantro and serve with lime wedges.

Other Recipes You Might Like

Butternut Squash Sage Risotto
Hard
Italian

Butternut Squash Sage Risotto

Creamy slow-stirred arborio risotto folded with roasted butternut squash and crispy sage butter. An elegant, velvety autumn dinner worth the stirring.

60 min
4 servings
dinnercomfortautumn

By Nina Marchetti

View Recipe
Crispy Coconut Shrimp with Sweet Chili Sauce
Medium
Thai

Crispy Coconut Shrimp with Sweet Chili Sauce

Shrimp coated in shredded coconut and gluten-free breadcrumbs, fried golden and crunchy, served with a sticky sweet chili dip. An irresistible crowd-pleaser.

32 min
4 servings
shrimpthaifried

By Priya Kaur

View Recipe
Seared Hanger Steak with Red Wine Shallot Sauce
Medium
French

Seared Hanger Steak with Red Wine Shallot Sauce

The butcher's cut done bistro-style: a well-seared hanger steak napped in a silky red wine and shallot reduction. Deeply flavorful and elegantly simple.

35 min
2 servings
hanger steakfrenchbistro

By Diego Alvarez

View Recipe

Want to Make Your Own Recipe?

Zestly's AI-powered recipe creator helps you design custom recipes tailored to your taste, ingredients, and dietary needs.

Create Your Recipe Now